Lineage for d1de4c3 (1de4 C:122-189,C:383-608)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25480Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
  4. 25553Superfamily c.56.5: Zn-dependent exopeptidases [53187] (5 families) (S)
  5. 25622Family c.56.5.5: Transferrin receptor ectodomain, protease-like domain [53210] (1 protein)
  6. 25623Protein Transferrin receptor ectodomain, protease-like domain [53211] (1 species)
  7. 25624Species Human (Homo sapiens) [TaxId:9606] [53212] (2 PDB entries)
  8. 25625Domain d1de4c3: 1de4 C:122-189,C:383-608 [33848]
    Other proteins in same PDB: d1de4a1, d1de4a2, d1de4b1, d1de4c1, d1de4c2, d1de4d1, d1de4d2, d1de4e1, d1de4f1, d1de4f2, d1de4g1, d1de4g2, d1de4h1, d1de4i1, d1de4i2

Details for d1de4c3

PDB Entry: 1de4 (more details), 2.8 Å

PDB Description: hemochromatosis protein hfe complexed with transferrin receptor

SCOP Domain Sequences for d1de4c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1de4c3 c.56.5.5 (C:122-189,C:383-608) Transferrin receptor ectodomain, protease-like domain {Human (Homo sapiens)}
lywddlkrklsekldstdftstikllnensyvpreagsqkdenlalyvenqfrefklskv
wrdqhfvkXeikilnifgvikgfvepdhyvvvgaqrdawgpgaaksgvgtalllklaqmf
sdmvlkdgfqpsrsiifaswsagdfgsvgatewlegylsslhlkaftyinldkavlgtsn
fkvsaspllytliektmqnvkhpvtgqflyqdsnwaskvekltldnaafpflaysgipav
sfcfcedtdypylgttmdtykelieripelnkvaraaaevagqfviklthdveln

SCOP Domain Coordinates for d1de4c3:

Click to download the PDB-style file with coordinates for d1de4c3.
(The format of our PDB-style files is described here.)

Timeline for d1de4c3: