Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (34 species) not a true protein |
Species Mycobacterium smegmatis [TaxId:246196] [338474] (1 PDB entry) |
Domain d5h46a_: 5h46 A: [338475] automated match to d1veqa_ complexed with fe2; mutant |
PDB Entry: 5h46 (more details), 2.85 Å
SCOPe Domain Sequences for d5h46a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h46a_ a.25.1.1 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]} lsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpneigvhemidpqvelvrgyadev aeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksiekle dldlvsqdlliahagelekfqwfvrahle
Timeline for d5h46a_: