Lineage for d5h46a_ (5h46 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2315402Protein automated matches [190041] (34 species)
    not a true protein
  7. 2316091Species Mycobacterium smegmatis [TaxId:246196] [338474] (1 PDB entry)
  8. 2316092Domain d5h46a_: 5h46 A: [338475]
    automated match to d1veqa_
    complexed with fe2; mutant

Details for d5h46a_

PDB Entry: 5h46 (more details), 2.85 Å

PDB Description: mycobacterium smegmatis dps1 mutant - f47e
PDB Compounds: (A:) DNA protection during starvation protein

SCOPe Domain Sequences for d5h46a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h46a_ a.25.1.1 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
lsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpneigvhemidpqvelvrgyadev
aeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksiekle
dldlvsqdlliahagelekfqwfvrahle

SCOPe Domain Coordinates for d5h46a_:

Click to download the PDB-style file with coordinates for d5h46a_.
(The format of our PDB-style files is described here.)

Timeline for d5h46a_: