Lineage for d6aqze_ (6aqz E:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430344Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2430345Protein automated matches [190069] (243 species)
    not a true protein
  7. 2431808Species Naegleria fowleri [TaxId:5763] [338422] (2 PDB entries)
  8. 2431813Domain d6aqze_: 6aqz E: [338466]
    Other proteins in same PDB: d6aqza2, d6aqzc2, d6aqzd2
    automated match to d4e5ya_
    complexed with edo, nap

Details for d6aqze_

PDB Entry: 6aqz (more details), 2.4 Å

PDB Description: crystal structure of a gdp-l-fucose synthetase from naegleria fowleri bound to nadp
PDB Compounds: (E:) gdp-l-fucose synthetase

SCOPe Domain Sequences for d6aqze_:

Sequence, based on SEQRES records: (download)

>d6aqze_ c.2.1.0 (E:) automated matches {Naegleria fowleri [TaxId: 5763]}
evsdqpitltqddvilvtggtglfgkavehivkkeqikgkwvflgskdgdlrdadackqp
fekyrptyvihlaafvgglfknmnfkvsfwldnvnmnnniltccydfgvkktisclstcv
fpdkieypiteeklhegpphfsnnayayakrmldmlgrwynekavnegksclftsviptn
lfgphdnfnveaghvlpglmhkcykaqqngtdfvvfgsgkplrqflyshdaarmllwtmf
nyqseepimlcvseedeksigqvaqtikdafnftgnmvfdtskadgqykktssnakflrl
nptfqytpfeqaiketvqwflenyetark

Sequence, based on observed residues (ATOM records): (download)

>d6aqze_ c.2.1.0 (E:) automated matches {Naegleria fowleri [TaxId: 5763]}
evsdqpitltqddvilvtggtglfgkavehivkkeqikgkwvflgskdgdlrdadackqp
fekyrptyvihlaafvgglfknmnfkvsfwldnvnmnnniltccydfgvkktisclstcv
fpdkieypiteeklhegpphfsnnayayakrmldmlgrwynekavnegksclftsviptn
lfgphdnfnveaghvlpglmhkcykaqqngtdfvvfgsgkplrqflyshdaarmllwtmf
nyqseepimlcvseedeksigqvaqtikdafnfttssnakflrlnptfqytpfeqaiket
vqwflenyetark

SCOPe Domain Coordinates for d6aqze_:

Click to download the PDB-style file with coordinates for d6aqze_.
(The format of our PDB-style files is described here.)

Timeline for d6aqze_: