Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) |
Family d.104.1.0: automated matches [227172] (1 protein) not a true family |
Protein automated matches [226887] (13 species) not a true protein |
Species Mycobacterium thermoresistibile [TaxId:1078020] [338442] (1 PDB entry) |
Domain d6aqhd2: 6aqh D:157-498 [338444] Other proteins in same PDB: d6aqha1, d6aqhb1, d6aqhc1, d6aqhd1 automated match to d3bjua2 protein/RNA complex; complexed with edo, krs, lys |
PDB Entry: 6aqh (more details), 2.35 Å
SCOPe Domain Sequences for d6aqhd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6aqhd2 d.104.1.0 (D:157-498) automated matches {Mycobacterium thermoresistibile [TaxId: 1078020]} seesrvrqryvdlivrdqarkvarqriavmrairsalerrgflevetpmlqtlaggaaar pfvthsnaldtelylriapelflkrclvggfervfelnrvfrnegadsthspefvmlety qaygtyddsavvtreliqevadeaigtrqvplpdgtvydldgewesiqmypslsealgee itpdtpaetlwaiadrlgldiprdrgyghgklveelwehtvgaklwaptfvkdfpvettp ltrshrsipgvtekwdlyvrrielatgyseltdpiiqrerfeaqaraaaagddeamalde dflaaleygmppstgtgmgidrlmmtltglsiretvlfpivk
Timeline for d6aqhd2: