Lineage for d6aqhd1 (6aqh D:10-156)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2059387Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2060461Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2060462Protein automated matches [190576] (33 species)
    not a true protein
  7. 2060548Species Mycobacterium thermoresistibile [TaxId:1078020] [338433] (1 PDB entry)
  8. 2060552Domain d6aqhd1: 6aqh D:10-156 [338438]
    Other proteins in same PDB: d6aqha2, d6aqhb2, d6aqhc2, d6aqhd2
    automated match to d3bjua1
    protein/RNA complex; complexed with edo, krs, lys

Details for d6aqhd1

PDB Entry: 6aqh (more details), 2.35 Å

PDB Description: crystal structure of lysyl-trna synthetase from mycobacterium thermoresistibile complexed with l-lysine and cladosporin
PDB Compounds: (D:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6aqhd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aqhd1 b.40.4.0 (D:10-156) automated matches {Mycobacterium thermoresistibile [TaxId: 1078020]}
dlpeqfrirqakradllaqgrqpypvdvprthtlleirqaypdlpvdartgeivgvtgrv
vfarnsgklcfatlqegdgtqlqamislaevgqealdnwktyvdigdivfvhgevitskr
gelsvladswqmaakalrplpvahkem

SCOPe Domain Coordinates for d6aqhd1:

Click to download the PDB-style file with coordinates for d6aqhd1.
(The format of our PDB-style files is described here.)

Timeline for d6aqhd1: