Lineage for d6amyc_ (6amy C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403213Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2403214Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2403226Family b.81.1.2: Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD [51165] (2 protein domains)
    contains extra N-terminal 3-helical domain
  6. 2403227Protein Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD [51166] (3 species)
  7. 2403228Species Acinetobacter baumannii [TaxId:470] [338168] (2 PDB entries)
  8. 2403232Domain d6amyc_: 6amy C: [338421]
    automated match to d3tdta_

Details for d6amyc_

PDB Entry: 6amy (more details), 2.85 Å

PDB Description: crystal structure of a 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate n- succinyltransferase from acinetobacter baumannii
PDB Compounds: (C:) 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase

SCOPe Domain Sequences for d6amyc_:

Sequence, based on SEQRES records: (download)

>d6amyc_ b.81.1.2 (C:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Acinetobacter baumannii [TaxId: 470]}
sqlstiieqafedranftaadcpseirqaveeaiagldngtlrvaekingewvvhqwlkk
avllsfklndnkpiescdlrfydkvetkfsgwteeqfkaagvrvvppavarrgsfqaknv
vlmpsyvnigayvdegtmvdtwatvgscaqigknvhlsggvgiggvleplqanptiiedn
cfigarseivegviveegsvismgvyigqstriydretgeihygrvpagsvvvpgnlpsa
dgkyslyaaiivkkvdaqtraktslndll

Sequence, based on observed residues (ATOM records): (download)

>d6amyc_ b.81.1.2 (C:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Acinetobacter baumannii [TaxId: 470]}
sqlstiieqafedranftaadcpseirqaveeaiagldngtlrvaekingewvvhqwlkk
avllsfklndnkpiescdlrfydkvetkfsgwteeqfkaagvrvvppavarrgsfqaknv
vlmpsyvnigayvdegtmvdtwatvgscaqigknvhlsggvgiggvleplqanptiiedn
cfigarseivegviveegsvismgvyigqstriydretgeihygrvpagsvvvpgnlpsa
dgkyslyaaiivkkvlndll

SCOPe Domain Coordinates for d6amyc_:

Click to download the PDB-style file with coordinates for d6amyc_.
(The format of our PDB-style files is described here.)

Timeline for d6amyc_: