Lineage for d1qq9a_ (1qq9 A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 72307Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
  4. 72401Superfamily c.56.5: Zn-dependent exopeptidases [53187] (5 families) (S)
  5. 72453Family c.56.5.4: Bacterial exopeptidases [53204] (2 proteins)
  6. 72454Protein Aminopeptidase [53205] (2 species)
  7. 72460Species Streptomyces griseus [TaxId:1911] [53207] (5 PDB entries)
  8. 72461Domain d1qq9a_: 1qq9 A: [33841]

Details for d1qq9a_

PDB Entry: 1qq9 (more details), 1.53 Å

PDB Description: streptomyces griseus aminopeptidase complexed with methionine

SCOP Domain Sequences for d1qq9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qq9a_ c.56.5.4 (A:) Aminopeptidase {Streptomyces griseus}
apdiplanvkahltqlstiaannggnrahgrpgykasvdyvkakldaagytttlqqftsg
gatgynlianwpggdpnkvlmagahldsvssgagindngsgsaavletalavsragyqpd
khlrfawwgaeelgligskfyvnnlpsadrsklagylnfdmigspnpgyfvydddpviek
tfknyfaglnvpteietegdgrsdhapfknvgvpvgglftgagytksaaqaqkwggtagq
afdrcyhsscdslsnindtaldrnsdaaahaiwtlss

SCOP Domain Coordinates for d1qq9a_:

Click to download the PDB-style file with coordinates for d1qq9a_.
(The format of our PDB-style files is described here.)

Timeline for d1qq9a_: