Lineage for d5w5cb_ (5w5c B:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2265467Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2266412Superfamily h.1.15: SNARE fusion complex [58038] (2 families) (S)
    tetrameric parallel coiled coil
  5. 2266413Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)
  6. 2266511Protein automated matches [254664] (2 species)
    not a true protein
  7. 2266516Species Norway rat (Rattus norvegicus) [TaxId:10116] [256060] (4 PDB entries)
  8. 2266519Domain d5w5cb_: 5w5c B: [338407]
    Other proteins in same PDB: d5w5cc_, d5w5cd_, d5w5cf1, d5w5cf2
    automated match to d1sfcj_
    complexed with gol, mg

Details for d5w5cb_

PDB Entry: 5w5c (more details), 1.85 Å

PDB Description: crystal structure of the primed snare-complexin-synaptotagmin-1 c2ab complex
PDB Compounds: (B:) syntaxin-1a

SCOPe Domain Sequences for d5w5cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w5cb_ h.1.15.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
alseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyv

SCOPe Domain Coordinates for d5w5cb_:

Click to download the PDB-style file with coordinates for d5w5cb_.
(The format of our PDB-style files is described here.)

Timeline for d5w5cb_: