Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.15: SNARE fusion complex [58038] (2 families) tetrameric parallel coiled coil |
Family h.1.15.1: SNARE fusion complex [58039] (12 proteins) |
Protein automated matches [254664] (2 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [256060] (5 PDB entries) |
Domain d5w5cb_: 5w5c B: [338407] Other proteins in same PDB: d5w5cc_, d5w5cd_, d5w5cf1, d5w5cf2 automated match to d1sfcj_ complexed with gol, mg |
PDB Entry: 5w5c (more details), 1.85 Å
SCOPe Domain Sequences for d5w5cb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5w5cb_ h.1.15.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} alseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyv
Timeline for d5w5cb_:
View in 3D Domains from other chains: (mouse over for more information) d5w5cc_, d5w5cd_, d5w5cf1, d5w5cf2 |