Lineage for d5w5df_ (5w5d F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2772795Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. 2772956Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 2772982Protein Synaptogamin I [49576] (3 species)
    duplication: contains tandem repeat of two similar domains
  7. 2773010Species Norway rat (Rattus norvegicus) [TaxId:10116] [49577] (12 PDB entries)
    Uniprot P21707 271-419 ! Uniprot P21707 271-419
  8. 2773024Domain d5w5df_: 5w5d F: [338403]
    Other proteins in same PDB: d5w5db_, d5w5dc_, d5w5dd_
    automated match to d1k5wa_
    complexed with mg

Details for d5w5df_

PDB Entry: 5w5d (more details), 2.5 Å

PDB Description: crystal structure of the primed snare-complexin-synaptotagmin-1 c2b complex
PDB Compounds: (F:) Synaptotagmin-1

SCOPe Domain Sequences for d5w5df_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w5df_ b.7.1.2 (F:) Synaptogamin I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qeklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkktt
ikkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrh
wsdmlanprrpiaqwhtlqveeevdamlavkk

SCOPe Domain Coordinates for d5w5df_:

Click to download the PDB-style file with coordinates for d5w5df_.
(The format of our PDB-style files is described here.)

Timeline for d5w5df_: