SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1ft7a_ (1ft7 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2126724Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2126919Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 protein domains)
  6. 2126930Protein Aminopeptidase [53205] (2 species)
  7. 2126931Species Aeromonas proteolytica [TaxId:671] [53206] (17 PDB entries)
    Uniprot Q01693
    synonym: Vibrio proteolyticus
  8. 2126947Domain d1ft7a_: 1ft7 A: [33840]
    complexed with k, plu, zn

Details for d1ft7a_

PDB Entry: 1ft7 (more details), 2.2 Å

PDB Description: aap complexed with l-leucinephosphonic acid
PDB Compounds: (A:) Bacterial leucyl aminopeptidase

SCOPe Domain Sequences for d1ft7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ft7a_ c.56.5.4 (A:) Aminopeptidase {Aeromonas proteolytica [TaxId: 671]}
mppitqqatvtawlpqvdasqitgtisslesftnrfytttsgaqasdwiasewqalsasl
pnasvkqvshsgynqksvvmtitgseapdewivigghldstigshtneqsvapgadddas
giaavtevirvlsennfqpkrsiafmayaaeevglrgsqdlanqyksegknvvsalqldm
tnykgsaqdvvfitdytdsnftqyltqlmdeylpsltygfdtcgyacsdhaswhnagypa
ampfeskfndynprihttqdtlansdptgshakkftqlglayaiemgsatg

SCOPe Domain Coordinates for d1ft7a_:

Click to download the PDB-style file with coordinates for d1ft7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ft7a_: