SCOPe 2.06: Domain d5w5cf2: 5w5c F:268-418

Lineage for d5w5cf2 (5w5c F:268-418)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families)
   two constituent families are related by circular permutation

5. Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
   topologically similar to the C-terminal domain of PapD

6. Protein Synaptogamin I [49576] (3 species)
   duplication: contains tandem repeat of two similar domains

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [49577] (9 PDB entries)
   Uniprot P21707 271-419 ! Uniprot P21707 271-419

8. Domain d5w5cf2: 5w5c F:268-418 [338394]
   Other proteins in same PDB: d5w5cb_, d5w5cc_, d5w5cd_
   automated match to d2r83a1
   complexed with gol, mg

Details for d5w5cf2

PDB Entry: 5w5c, 1.85 Å

PDB Description: crystal structure of the primed snare-complexin-synaptotagmin-1 c2ab complex

PDB Compounds: (F:) Synaptotagmin-1

SCOPe Domain Sequences for d5w5cf2:

Sequence; same for both SEQRES and ATOM records:

>d5w5cf2 b.7.1.2 (F:268-418) Synaptogamin I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eeqeklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkk
ttikkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgael
rhwsdmlanprrpiaqwhtlqveeevdamla

Timeline for d5w5cf2:

• d5w5cf2 is new in SCOPe 2.06-stable
  
• d5w5cf2 appears in SCOPe 2.07
  
• d5w5cf2 appears in the current release, SCOPe 2.08