Lineage for d5w5cf2 (5w5c F:268-418)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2045100Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2045101Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2045249Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 2045274Protein Synaptogamin I [49576] (3 species)
    duplication: contains tandem repeat of two similar domains
  7. 2045293Species Norway rat (Rattus norvegicus) [TaxId:10116] [49577] (9 PDB entries)
    Uniprot P21707 271-419 ! Uniprot P21707 271-419
  8. 2045300Domain d5w5cf2: 5w5c F:268-418 [338394]
    Other proteins in same PDB: d5w5cb_, d5w5cc_, d5w5cd_
    automated match to d2r83a1
    complexed with gol, mg

Details for d5w5cf2

PDB Entry: 5w5c (more details), 1.85 Å

PDB Description: crystal structure of the primed snare-complexin-synaptotagmin-1 c2ab complex
PDB Compounds: (F:) Synaptotagmin-1

SCOPe Domain Sequences for d5w5cf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w5cf2 b.7.1.2 (F:268-418) Synaptogamin I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eeqeklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkk
ttikkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgael
rhwsdmlanprrpiaqwhtlqveeevdamla

SCOPe Domain Coordinates for d5w5cf2:

Click to download the PDB-style file with coordinates for d5w5cf2.
(The format of our PDB-style files is described here.)

Timeline for d5w5cf2: