| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.1: Parallel coiled-coil [57943] (38 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.15: SNARE fusion complex [58038] (2 families) ![]() tetrameric parallel coiled coil |
| Family h.1.15.1: SNARE fusion complex [58039] (12 proteins) |
| Protein automated matches [254664] (2 species) not a true protein |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [256060] (4 PDB entries) |
| Domain d5w5db_: 5w5d B: [338377] Other proteins in same PDB: d5w5dc_, d5w5dd_, d5w5df_ automated match to d1sfcj_ complexed with mg |
PDB Entry: 5w5d (more details), 2.5 Å
SCOPe Domain Sequences for d5w5db_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5w5db_ h.1.15.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyve
Timeline for d5w5db_: