Lineage for d1amp__ (1amp -)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 587177Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 587552Superfamily c.56.5: Zn-dependent exopeptidases [53187] (6 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 587640Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (12 proteins)
  6. 587645Protein Aminopeptidase [53205] (2 species)
  7. 587646Species Aeromonas proteolytica [TaxId:671] [53206] (7 PDB entries)
    synonym: Vibrio proteolyticus
  8. 587649Domain d1amp__: 1amp - [33837]
    complexed with zn

Details for d1amp__

PDB Entry: 1amp (more details), 1.8 Å

PDB Description: crystal structure of aeromonas proteolytica aminopeptidase: a prototypical member of the co-catalytic zinc enzyme family

SCOP Domain Sequences for d1amp__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1amp__ c.56.5.4 (-) Aminopeptidase {Aeromonas proteolytica}
mppitqqatvtawlpqvdasqitgtisslesftnrfytttsgaqasdwiasewqalsasl
pnasvkqvshsgynqksvvmtitgseapdewivigghldstigshtneqsvapgadddas
giaavtevirvlsennfqpkrsiafmayaaeevglrgsqdlanqyksegknvvsalqldm
tnykgsaqdvvfitdytdsnftqyltqlmdeylpsltygfdtcgyacsdhaswhnagypa
ampfeskfndynprihttqdtlansdptgshakkftqlglayaiemgsatg

SCOP Domain Coordinates for d1amp__:

Click to download the PDB-style file with coordinates for d1amp__.
(The format of our PDB-style files is described here.)

Timeline for d1amp__: