Lineage for d1bpna1 (1bpn A:160-484)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889494Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2889696Family c.56.5.3: Leucine aminopeptidase, C-terminal domain [53201] (2 proteins)
    automatically mapped to Pfam PF00883
  6. 2889697Protein Leucine aminopeptidase, C-terminal domain [53202] (2 species)
  7. 2889698Species Cow (Bos taurus) [TaxId:9913] [53203] (7 PDB entries)
  8. 2889704Domain d1bpna1: 1bpn A:160-484 [33836]
    Other proteins in same PDB: d1bpna2
    complexed with zn

Details for d1bpna1

PDB Entry: 1bpn (more details), 2.9 Å

PDB Description: differentiation and identification of the two catalytic metal binding sites in bovine lens leucine aminopeptidase by x-ray crystallography
PDB Compounds: (A:) leucine aminopeptidase

SCOPe Domain Sequences for d1bpna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bpna1 c.56.5.3 (A:160-484) Leucine aminopeptidase, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
fasgqnlarrlmetpanemtptkfaeiveenlksasiktdvfirpkswieeqemgsflsv
akgseeppvfleihykgspnasepplvfvgkgitfdsggisikaaanmdlmradmggaat
icsaivsaakldlpinivglaplcenmpsgkankpgdvvrarngktiqvdntdaegrlil
adalcyahtfnpkviinaatltgamdialgsgatgvftnsswlwnklfeasietgdrvwr
mplfehytrqvidcqladvnnigkyrsagactaaaflkefvthpkwahldiagvmtnkde
vpylrkgmagrptrtlieflfrfsq

SCOPe Domain Coordinates for d1bpna1:

Click to download the PDB-style file with coordinates for d1bpna1.
(The format of our PDB-style files is described here.)

Timeline for d1bpna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bpna2