Class b: All beta proteins [48724] (180 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) |
Family b.43.4.0: automated matches [227162] (1 protein) not a true family |
Protein automated matches [226870] (22 species) not a true protein |
Species Maize (Zea mays) [TaxId:4577] [226539] (17 PDB entries) |
Domain d5vw4a1: 5vw4 A:8-156 [338357] Other proteins in same PDB: d5vw4a2 automated match to d3lvba1 complexed with fad, mg, nca; mutant |
PDB Entry: 5vw4 (more details), 1.35 Å
SCOPe Domain Sequences for d5vw4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vw4a1 b.43.4.0 (A:8-156) automated matches {Maize (Zea mays) [TaxId: 4577]} skvsvaplhlesakepplntykpkepftativsveslvgpkapgetchividhggnvpyw egqsygvippgenpkkpgapqnvrlysiastrygdnfdgrtgslcvrravyydpetgked pskngvcsnflcnskpgdkiqltgpsgki
Timeline for d5vw4a1: