Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
Family c.56.5.3: Leucine aminopeptidase, C-terminal domain [53201] (2 proteins) automatically mapped to Pfam PF00883 |
Protein Leucine aminopeptidase, C-terminal domain [53202] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [53203] (7 PDB entries) |
Domain d1blle2: 1bll E:160-484 [33833] Other proteins in same PDB: d1blle1 complexed with zn |
PDB Entry: 1bll (more details), 2.4 Å
SCOPe Domain Sequences for d1blle2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1blle2 c.56.5.3 (E:160-484) Leucine aminopeptidase, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]} fasgqnlarrlmetpanemtptkfaeiveenlksasiktdvfirpkswieeqemgsflsv akgseeppvfleihykgspnasepplvfvgkgitfdsggisikaaanmdlmradmggaat icsaivsaakldlpinivglaplcenmpsgkankpgdvvrarngktiqvdntdaegrlil adalcyahtfnpkviinaatltgamdialgsgatgvftnsswlwnklfeasietgdrvwr mplfehytrqvidcqladvnnigkyrsagactaaaflkefvthpkwahldiagvmtnkde vpylrkgmagrptrtlieflfrfsq
Timeline for d1blle2: