Class b: All beta proteins [48724] (177 folds) |
Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily) duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain |
Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) |
Family b.98.1.1: Zn aminopeptidase N-terminal domain [63738] (4 proteins) |
Protein Leukotriene A4 hydrolase N-terminal domain [63739] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63740] (56 PDB entries) Uniprot P09960 |
Domain d5niec1: 5nie C:4-208 [338322] Other proteins in same PDB: d5niea2, d5niea3, d5nieb2, d5nieb3, d5niec2, d5niec3 automated match to d3b7sa2 complexed with zn; mutant |
PDB Entry: 5nie (more details), 2.6 Å
SCOPe Domain Sequences for d5niec1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5niec1 b.98.1.1 (C:4-208) Leukotriene A4 hydrolase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} vdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdltiek vvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltpeqt sgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpdped psrkiykfiqkvpipcylialvvga
Timeline for d5niec1: