SCOPe 2.08: Domain d5vqwa2: 5vqw A:430-552

Lineage for d5vqwa2 (5vqw A:430-552)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId:11678] [275362] (22 PDB entries)

8. Domain d5vqwa2: 5vqw A:430-552 [338311]
   Other proteins in same PDB: d5vqwa1, d5vqwa3, d5vqwb_
   automated match to d1dloa1
   complexed with 9kd, so4

Details for d5vqwa2

PDB Entry: 5vqw, 2.5 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase (y181c) variant in complex with n-(6-cyano-3-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin- 1(2h)-yl)ethoxy)phenoxy)-4-methylnaphthalen-1-yl)acrylamide (jlj685), a non-nucleoside inhibitor

PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d5vqwa2:

Sequence; same for both SEQRES and ATOM records:

>d5vqwa2 c.55.3.0 (A:430-552) automated matches {Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klv

Timeline for d5vqwa2:

• d5vqwa2 first appeared in SCOPe 2.06
  
• d5vqwa2 appears in SCOPe 2.07