Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies) |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (5 families) |
Family c.56.5.3: Leucine aminopeptidase, C-terminal domain [53201] (1 protein) |
Protein Leucine aminopeptidase, C-terminal domain [53202] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [53203] (7 PDB entries) |
Domain d1lcpb2: 1lcp B:160-484 [33831] Other proteins in same PDB: d1lcpa1, d1lcpb1 |
PDB Entry: 1lcp (more details), 1.65 Å
SCOP Domain Sequences for d1lcpb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lcpb2 c.56.5.3 (B:160-484) Leucine aminopeptidase, C-terminal domain {Cow (Bos taurus)} fasgqnlarrlmetpanemtptkfaeiveenlksasiktdvfirpkswieeqemgsflsv akgseeppvfleihykgspnasepplvfvgkgitfdsggisikaaanmdlmradmggaat icsaivsaakldlpinivglaplcenmpsgkankpgdvvrarngktiqvdntdaegrlil adalcyahtfnpkviinaatltgamdialgsgatgvftnsswlwnklfeasietgdrvwr mplfehytrqvidcqladvnnigkyrsagactaaaflkefvthpkwahldiagvmtnkde vpylrkgmagrptrtlieflfrfsq
Timeline for d1lcpb2: