SCOP 1.55: Domain d1lcpb2: 1lcp B:160-484

Lineage for d1lcpb2 (1lcp B:160-484)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (5 families)

5. Family c.56.5.3: Leucine aminopeptidase, C-terminal domain [53201] (1 protein)

6. Protein Leucine aminopeptidase, C-terminal domain [53202] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53203] (7 PDB entries)

8. Domain d1lcpb2: 1lcp B:160-484 [33831]
   Other proteins in same PDB: d1lcpa1, d1lcpb1

Details for d1lcpb2

PDB Entry: 1lcp, 1.65 Å

PDB Description: bovine lens leucine aminopeptidase complexed with l-leucine phosphonic acid

SCOP Domain Sequences for d1lcpb2:

Sequence; same for both SEQRES and ATOM records:

>d1lcpb2 c.56.5.3 (B:160-484) Leucine aminopeptidase, C-terminal domain {Cow (Bos taurus)}
fasgqnlarrlmetpanemtptkfaeiveenlksasiktdvfirpkswieeqemgsflsv
akgseeppvfleihykgspnasepplvfvgkgitfdsggisikaaanmdlmradmggaat
icsaivsaakldlpinivglaplcenmpsgkankpgdvvrarngktiqvdntdaegrlil
adalcyahtfnpkviinaatltgamdialgsgatgvftnsswlwnklfeasietgdrvwr
mplfehytrqvidcqladvnnigkyrsagactaaaflkefvthpkwahldiagvmtnkde
vpylrkgmagrptrtlieflfrfsq

Timeline for d1lcpb2:

• d1lcpb2 appears in SCOP 1.57
  
• d1lcpb2 appears in the current release, SCOPe 2.08