Lineage for d5uhua_ (5uhu A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (73 species)
    not a true protein
  7. 2331924Species Micromonospora griseorubida [TaxId:28040] [226290] (10 PDB entries)
  8. 2331946Domain d5uhua_: 5uhu A: [338296]
    automated match to d4mm0b_
    complexed with hem, miv

Details for d5uhua_

PDB Entry: 5uhu (more details)

PDB Description: solution conformation of cytochrome p450 mycg with mycinamicin iv bound
PDB Compounds: (A:) Mycinamicin IV hydroxylase/epoxidase

SCOPe Domain Sequences for d5uhua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uhua_ a.104.1.0 (A:) automated matches {Micromonospora griseorubida [TaxId: 28040]}
epraypfndvhgltlagrygelqetepvsrvrppygeeawlvtryedvravlgdgrfvrg
psmtrdeprtrpemvkggllsmdppehsrlrrlvvkaftarraeslrprareiahelvdq
maatgqpadlvamfarqlpvrvicellgvpsadhdrftrwsgaflstaevtaeemqeaae
qayaymgdlidrrrkeptddlvsalvqardqqdslseqelldlaigllvagyestttqia
dfvyllmtrpelrrqlldrpelipsaveeltrwvplgvgtafpryavedvtlrgvtirag
epvlastgaanrdqaqfpdadridvdrtpnqhlgfghgvhhclgaplarvelqvalevll
qrlpgirlgipetqlrwsegmllrgplelpvvw

SCOPe Domain Coordinates for d5uhua_:

Click to download the PDB-style file with coordinates for d5uhua_.
(The format of our PDB-style files is described here.)

Timeline for d5uhua_: