Class b: All beta proteins [48724] (178 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.1: Legume lectins [49900] (5 proteins) |
Protein automated matches [190035] (28 species) not a true protein |
Species Canavalia bonariensis [TaxId:192414] [338285] (1 PDB entry) |
Domain d5u3ea_: 5u3e A: [338286] automated match to d2p2ka_ complexed with ca, mma, mn |
PDB Entry: 5u3e (more details), 2.3 Å
SCOPe Domain Sequences for d5u3ea_:
Sequence, based on SEQRES records: (download)
>d5u3ea_ b.29.1.1 (A:) automated matches {Canavalia bonariensis [TaxId: 192414]} adtivaveldtypntdigdpnyphigidiksirskkttrwniqngkvgtahinynsvgkr lsaivsypnsdsatvsydvdldnvlpewvrvglsattglyketntilswsftsklksnst adanalhftfnqfskdqkdlilqgdattgtdgnleltrvssngspqgnsvgralfyapvh iwessavvasfdatfkflikspdsepadgitffianidssipsgsggrllglfpdan
>d5u3ea_ b.29.1.1 (A:) automated matches {Canavalia bonariensis [TaxId: 192414]} adtivaveldtypntdigdpnyphigidiksirskkttrwniqngkvgtahinynsvgkr lsaivsypnsdsatvsydvdldnvlpewvrvglsattglyketntilswsftsklkstad analhftfnqfskdqkdlilqgdattgtdgnleltrvssngspqgnsvgralfyapvhiw essavvasfdatfkflikspdsepadgitffianidssipsgsggrllglfpdan
Timeline for d5u3ea_: