Lineage for d5u3ea_ (5u3e A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778888Protein automated matches [190035] (28 species)
    not a true protein
  7. 2778951Species Canavalia bonariensis [TaxId:192414] [338285] (1 PDB entry)
  8. 2778952Domain d5u3ea_: 5u3e A: [338286]
    automated match to d2p2ka_
    complexed with ca, mma, mn

Details for d5u3ea_

PDB Entry: 5u3e (more details), 2.3 Å

PDB Description: crystal structure of native lectin from canavalia bonariensis seeds (cabo) complexed with alpha-methyl-d-mannoside
PDB Compounds: (A:) Canavalia bonariensis seed lectin

SCOPe Domain Sequences for d5u3ea_:

Sequence, based on SEQRES records: (download)

>d5u3ea_ b.29.1.1 (A:) automated matches {Canavalia bonariensis [TaxId: 192414]}
adtivaveldtypntdigdpnyphigidiksirskkttrwniqngkvgtahinynsvgkr
lsaivsypnsdsatvsydvdldnvlpewvrvglsattglyketntilswsftsklksnst
adanalhftfnqfskdqkdlilqgdattgtdgnleltrvssngspqgnsvgralfyapvh
iwessavvasfdatfkflikspdsepadgitffianidssipsgsggrllglfpdan

Sequence, based on observed residues (ATOM records): (download)

>d5u3ea_ b.29.1.1 (A:) automated matches {Canavalia bonariensis [TaxId: 192414]}
adtivaveldtypntdigdpnyphigidiksirskkttrwniqngkvgtahinynsvgkr
lsaivsypnsdsatvsydvdldnvlpewvrvglsattglyketntilswsftsklkstad
analhftfnqfskdqkdlilqgdattgtdgnleltrvssngspqgnsvgralfyapvhiw
essavvasfdatfkflikspdsepadgitffianidssipsgsggrllglfpdan

SCOPe Domain Coordinates for d5u3ea_:

Click to download the PDB-style file with coordinates for d5u3ea_.
(The format of our PDB-style files is described here.)

Timeline for d5u3ea_: