![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.5: Zn-dependent exopeptidases [53187] (6 families) ![]() core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
![]() | Family c.56.5.1: Pancreatic carboxypeptidases [53188] (4 proteins) |
![]() | Protein Carboxypeptidase D, catalytic domain [53196] (1 species) |
![]() | Species Crested duck (Lophonetta specularioides) [TaxId:8836] [53197] (2 PDB entries) |
![]() | Domain d1qmua2: 1qmu A:4-304 [33827] Other proteins in same PDB: d1qmua1 complexed with man, nag, so4, zn |
PDB Entry: 1qmu (more details), 2.7 Å
SCOP Domain Sequences for d1qmua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qmua2 c.56.5.1 (A:4-304) Carboxypeptidase D, catalytic domain {Crested duck (Lophonetta specularioides)} qavqpvdfrhhhfsdmeiflrryaneypsitrlysvgksvelrelyvmeisdnpgiheag epefkyignmhgnevvgrelllnlieylcknfgtdpevtdlvqstrihimpsmnpdgyek sqegdrggtvgrnnsnnydlnrnfpdqffqvtdppqpetlavmswlktypfvlsanlhgg slvvnypfdddeqgiaiyskspddavfqqlalsyskenkkmyqgspckdlypteyfphgi tngaqwynvpggmqdwnylntncfevtielgcvkypkaeelpkyweqnrrsllqfikqvh r
Timeline for d1qmua2: