SCOPe 2.08: Domain d1cpb.1: 1cpb A:,B:

Lineage for d1cpb.1 (1cpb A:,B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)

6. Protein Carboxypeptidase B [53193] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53195] (1 PDB entry)

8. Domain d1cpb.1: 1cpb A:,B: [33826]
   CA-atoms only

Details for d1cpb.1

PDB Entry: 1cpb, 2.8 Å

PDB Description: structure of carboxypeptidase b at 2.8 angstroms resolution

PDB Compounds: (A:) carboxypeptidase b, (B:) carboxypeptidase b

SCOPe Domain Sequences for d1cpb.1:

Sequence; same for both SEQRES and ATOM records:

>g1cpb.1 c.56.5.1 (A:,B:) Carboxypeptidase B {Cow (Bos taurus) [TaxId: 9913]}
ttghsyekynnwetieawteqvasenpdlisrsaigttflgntiyllkvgkpgsnkpavf
mdcgfharewispafcqwfvreXeihmtefldkldfyvlpvvnidgyiytwttnrmwrkt
rstragssctgtdlnrnfdagwcsigasnnpcsetycgsaaesekeskavadfirnhlss
ikayltihsysqmmlypysydyklpknnvelntlakgavkklaslhgttysygpgattiy
pasggsddwaydqgikysftfelrdkgrygfvlpesqiqptceetmlaikyvtsyvlehl

Timeline for d1cpb.1:

• d1cpb.1 first appeared (with stable ids) in SCOP 1.55, called d1cpb__
  
• d1cpb.1 appears in SCOPe 2.07