SCOPe 2.06: Domain d5ogub1: 5ogu B:1-93

Lineage for d5ogub1 (5ogu B:1-93)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
   core: 4 helices; bundle, partly opened, capped with a beta-sheet

4. Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families)
   dimer of identical subunits

5. Family a.55.1.0: automated matches [191573] (1 protein)
   not a true family

6. Protein automated matches [191007] (8 species)
   not a true protein

7. Species Spiroplasma melliferum [TaxId:570509] [260909] (4 PDB entries)

8. Domain d5ogub1: 5ogu B:1-93 [338253]
   Other proteins in same PDB: d5ogua2, d5ogub2
   automated match to d1owfa_

Details for d5ogub1

PDB Entry: 5ogu

PDB Description: structure of dna-binding hu protein from micoplasma spiroplasma melliferum

PDB Compounds: (B:) DNA-binding protein

SCOPe Domain Sequences for d5ogub1:

Sequence; same for both SEQRES and ATOM records:

>d5ogub1 a.55.1.0 (B:1-93) automated matches {Spiroplasma melliferum [TaxId: 570509]}
mskkelaaqiaekftdvlskthaeeitnfvfdhikkalvagkevsiagfgkfavteraar
dgrnpstgetikipasksakfkagkqlktdlnn

Timeline for d5ogub1:

• d5ogub1 is new in SCOPe 2.06-stable
  
• d5ogub1 appears in SCOPe 2.07
  
• d5ogub1 appears in the current release, SCOPe 2.08