Lineage for d5ogub1 (5ogu B:1-93)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715141Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 2715142Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 2715207Family a.55.1.0: automated matches [191573] (1 protein)
    not a true family
  6. 2715208Protein automated matches [191007] (11 species)
    not a true protein
  7. 2715235Species Spiroplasma melliferum [TaxId:570509] [260909] (3 PDB entries)
  8. 2715239Domain d5ogub1: 5ogu B:1-93 [338253]
    Other proteins in same PDB: d5ogua2, d5ogub2
    automated match to d1owfa_

Details for d5ogub1

PDB Entry: 5ogu (more details)

PDB Description: structure of dna-binding hu protein from micoplasma spiroplasma melliferum
PDB Compounds: (B:) DNA-binding protein

SCOPe Domain Sequences for d5ogub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ogub1 a.55.1.0 (B:1-93) automated matches {Spiroplasma melliferum [TaxId: 570509]}
mskkelaaqiaekftdvlskthaeeitnfvfdhikkalvagkevsiagfgkfavteraar
dgrnpstgetikipasksakfkagkqlktdlnn

SCOPe Domain Coordinates for d5ogub1:

Click to download the PDB-style file with coordinates for d5ogub1.
(The format of our PDB-style files is described here.)

Timeline for d5ogub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ogub2