SCOPe 2.07: Domain d1nsaa1: 1nsa A:4-308

Lineage for d1nsaa1 (1nsa A:4-308)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)

6. Protein Carboxypeptidase B [53193] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [53194] (18 PDB entries)

8. Domain d1nsaa1: 1nsa A:4-308 [33825]
   Other proteins in same PDB: d1nsaa2
   zymogen
   complexed with ben, zn

Details for d1nsaa1

PDB Entry: 1nsa, 2.3 Å

PDB Description: three-dimensional structure of porcine procarboxypeptidase b: a structural basis of its inactivity

PDB Compounds: (A:) Procarboxypeptidase B

SCOPe Domain Sequences for d1nsaa1:

Sequence; same for both SEQRES and ATOM records:

>d1nsaa1 c.56.5.1 (A:4-308) Carboxypeptidase B {Pig (Sus scrofa) [TaxId: 9823]}
ttghsyekynnwetieawteqvtsknpdlisrsaigttfdgdniyllkvgkpgsnkpaif
mdcgfharewisqafcqwfvrdavrtygyeahmtefldnldfyvlpvlnidgyiytwtkn
rmwrktrstnagssctgtdpnrnfnagwctvgasvnpcnetycgsaaeseketkaladfi
rnnlssikayltihsysqmilypysydyklpendaelnslakgavkelaslygtsysygp
gsttiypaaggsddwaynqgikysftfelrdkgrfgfvlpesqiqatcqetmlavkyvtn
ytlehl

Timeline for d1nsaa1:

• d1nsaa1 first appeared (with stable ids) in SCOP 1.55, called d1nsa_1
  
• d1nsaa1 appears in SCOPe 2.06
  
• d1nsaa1 appears in the current release, SCOPe 2.08