Lineage for d1nsaa1 (1nsa A:4-308)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140812Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2142305Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2142306Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)
  6. 2142373Protein Carboxypeptidase B [53193] (4 species)
  7. 2142383Species Pig (Sus scrofa) [TaxId:9823] [53194] (11 PDB entries)
  8. 2142391Domain d1nsaa1: 1nsa A:4-308 [33825]
    Other proteins in same PDB: d1nsaa2
    zymogen
    complexed with ben, zn

Details for d1nsaa1

PDB Entry: 1nsa (more details), 2.3 Å

PDB Description: three-dimensional structure of porcine procarboxypeptidase b: a structural basis of its inactivity
PDB Compounds: (A:) Procarboxypeptidase B

SCOPe Domain Sequences for d1nsaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nsaa1 c.56.5.1 (A:4-308) Carboxypeptidase B {Pig (Sus scrofa) [TaxId: 9823]}
ttghsyekynnwetieawteqvtsknpdlisrsaigttfdgdniyllkvgkpgsnkpaif
mdcgfharewisqafcqwfvrdavrtygyeahmtefldnldfyvlpvlnidgyiytwtkn
rmwrktrstnagssctgtdpnrnfnagwctvgasvnpcnetycgsaaeseketkaladfi
rnnlssikayltihsysqmilypysydyklpendaelnslakgavkelaslygtsysygp
gsttiypaaggsddwaynqgikysftfelrdkgrfgfvlpesqiqatcqetmlavkyvtn
ytlehl

SCOPe Domain Coordinates for d1nsaa1:

Click to download the PDB-style file with coordinates for d1nsaa1.
(The format of our PDB-style files is described here.)

Timeline for d1nsaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nsaa2