Lineage for d5onca2 (5onc A:269-391)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2524590Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2524591Protein automated matches [196909] (81 species)
    not a true protein
  7. 2525226Species Mycobacterium tuberculosis [TaxId:83332] [228163] (17 PDB entries)
  8. 2525274Domain d5onca2: 5onc A:269-391 [338242]
    Other proteins in same PDB: d5onca3
    automated match to d4wysa2
    complexed with cl

Details for d5onca2

PDB Entry: 5onc (more details), 2.19 Å

PDB Description: catabolism of the cholesterol side chain in mycobacterium tuberculosis is controlled by a redox-sensitive thiol switch
PDB Compounds: (A:) Steroid 3-ketoacyl-CoA thiolase

SCOPe Domain Sequences for d5onca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5onca2 c.95.1.0 (A:269-391) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
tprarivaqalvgaepyyhldgpvqstakvlekagmkigdidiveineafasvvlswarv
hepdmdrvnvnggaialghpvgctgsrlittalhelertdqslalitmcaggalstgtii
eri

SCOPe Domain Coordinates for d5onca2:

Click to download the PDB-style file with coordinates for d5onca2.
(The format of our PDB-style files is described here.)

Timeline for d5onca2: