Lineage for d1aye_1 (1aye 1-309)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies) 
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (5 families) 
Family c.56.5.1: Pancreatic carboxypeptidases [53188] (3 proteins) Protein Carboxypeptidase A [53189] (3 species) 
Species Human (Homo sapiens) [TaxId:9606] [53192] (2 PDB entries) 
Domain d1aye_1: 1aye 1-309 [33824]
Other proteins in same PDB: d1aye_2
Details for d1aye_1
PDB Entry: 1aye (more details), 1.8 Å
PDB Description: human procarboxypeptidase a2
SCOP Domain Sequences for d1aye_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aye_1 c.56.5.1 (1-309) Carboxypeptidase A {Human (Homo sapiens)}
ersgnfnfgayhtleeisqemdnlvaehpglvskvnigssfenrpmnvlkfstggdkpai
wldagiharewvtqatalwtankivsdygkdpsitsildaldifllpvtnpdgyvfsqtk
nrmwrktrskvsgslcvgvdpnrnwdagfggpgassnpcsdsyhgpsansevevksivdf
ikshgkvkafiilhsysqllmfpygykctklddfdelsevaqkaaqslrslhgtkykvgp
icsviyqasggsidwsydygikysfafelrdtgrygfllparqilptaeetwlglkaime
hvrdhpy
SCOP Domain Coordinates for d1aye_1:
Click to download the PDB-style file with coordinates for d1aye_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aye_1:
- d1aye_1 appears in SCOP 1.57
- d1aye_1 appears in the current release, SCOPe 2.08, called d1ayea1
View in 3D
