Lineage for d5oncb1 (5onc B:1-268)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917965Species Mycobacterium tuberculosis [TaxId:83332] [228163] (23 PDB entries)
  8. 2918026Domain d5oncb1: 5onc B:1-268 [338237]
    Other proteins in same PDB: d5onca3
    automated match to d4wysa1
    complexed with cl

Details for d5oncb1

PDB Entry: 5onc (more details), 2.19 Å

PDB Description: catabolism of the cholesterol side chain in mycobacterium tuberculosis is controlled by a redox-sensitive thiol switch
PDB Compounds: (B:) Steroid 3-ketoacyl-CoA thiolase

SCOPe Domain Sequences for d5oncb1:

Sequence, based on SEQRES records: (download)

>d5oncb1 c.95.1.0 (B:1-268) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mgypviveatrspigkrngwlsglhatellgavqkavvdkagiqsglhagdveqviggcv
tqfgeqsnnisrvawltaglpehvgattvdcqcgsgqqanhliagliaagaidvgiacgi
eamsrvglganagpdrsliraqswdidlpnqfeaaeriakrrgitredvdvfglesqrra
qrawaegrfdreispiqapvldeqnqptgerrlvfrdqglrettmaglgelkpvleggih
tagtssqisdgaaavlwmdeavarahgl

Sequence, based on observed residues (ATOM records): (download)

>d5oncb1 c.95.1.0 (B:1-268) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mgypviveatrspigkrngwlsglhatellgavqkavvdkagiqsglhagdveqviggcv
tqsnnisrvawltaglpehvgattvdcqcgsgqqanhliagliaagaidvgiacgieams
pnqfeaaeriakrrgitredvdvfglesqrraqrawaegrfdreispiqapvldeqnqpt
lvfrdqglrettmaglgelkpvleggihtagtssqisdgaaavlwmdeavarahgl

SCOPe Domain Coordinates for d5oncb1:

Click to download the PDB-style file with coordinates for d5oncb1.
(The format of our PDB-style files is described here.)

Timeline for d5oncb1: