Lineage for d5ojkb_ (5ojk B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2152916Species Human (Homo sapiens) [TaxId:9606] [188340] (73 PDB entries)
  8. 2153060Domain d5ojkb_: 5ojk B: [338235]
    automated match to d2whpb_
    complexed with nag, pge

Details for d5ojkb_

PDB Entry: 5ojk (more details), 2.55 Å

PDB Description: crystal structure of the human neuroligin 1 cholinesterase domain containing spliced sequence b (ssb) (nl1(-a+b))
PDB Compounds: (B:) Neuroligin-1,Neuroligin-1

SCOPe Domain Sequences for d5ojkb_:

Sequence, based on SEQRES records: (download)

>d5ojkb_ c.69.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dplvatnfgkirgikkelnneilgpviqflgvpyaapptgerrfqppeppspwsdirnat
qfapvcpqniidgrlpevmlpvwftnnldvvssyvqdqsedclylniyvpteddirdsgg
pkpvmvyihggsymegtgnlydgsvlasygnvivitvnyrlgvlgflstgdqaakgnygl
ldliqalrwtsenigffggdplritvfgsgaggscvnlltlshysegnrwsnstkglfqr
aiaqsgtalsswavsfqpakyarmlatkvgcnvsdtvelveclqkkpykelvdqdiqpar
yhiafgpvidgdvipddpqilmeqgeflnydimlgvnqgeglkfvenivdsddgisasdf
dfavsnfvdnlygypegkdvlretikfmytdwadrhnpetrrktllalftdhqwvapava
tadlhsnfgsptyfyafyhhcqtdqvpawadaahgdevpyvlgipmigptelfpcnfskn
dvmlsavvmtywtnfaktgdpnqpvpqdtkfihtkpnrfeevawtrysqkdqlylhiglk
prvkehyrankvnlwlelvphl

Sequence, based on observed residues (ATOM records): (download)

>d5ojkb_ c.69.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dplvatnfgkirgikkelnneilgpviqflgvpyaapptgerrfqppeppspwsdirnat
qfapvcpqniidrlpevmlpvwftnnldvvssyvqdqsedclylniyvptgpkpvmvyih
ggsymegtgnlydgsvlasygnvivitvnyrlgvlgflstgdqaakgnyglldliqalrw
tsenigffggdplritvfgsgaggscvnlltlshysegnrwsnstkglfqraiaqsgtal
sswavsfqpakyarmlatkvgcnvsdtvelveclqkkpykelvdqdiqparyhiafgpvi
dgdvipddpqilmeqgeflnydimlgvnqgeglkfvenivdsddgisasdfdfavsnfvd
nlygypgkdvlretikfmytdwadrhnpetrrktllalftdhqwvapavatadlhsnfgs
ptyfyafyhhcqtdqvpawadaahgdevpyvlgipmigptelfpcnfskndvmlsavvmt
ywtnfaktgdpnqpvpvawtrysqkdqlylhiglkprvkehyrankvnlwlelvphl

SCOPe Domain Coordinates for d5ojkb_:

Click to download the PDB-style file with coordinates for d5ojkb_.
(The format of our PDB-style files is described here.)

Timeline for d5ojkb_: