SCOPe 2.08: Domain d5me7d1: 5me7 D:53-235

Lineage for d5me7d1 (5me7 D:53-235)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.86: eIF4e-like [55417] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478

4. Superfamily d.86.1: eIF4e-like [55418] (3 families)

5. Family d.86.1.0: automated matches [191459] (1 protein)
   not a true family

6. Protein automated matches [190708] (10 species)
   not a true protein

7. Species Cucumis melo [TaxId:3656] [338181] (3 PDB entries)

8. Domain d5me7d1: 5me7 D:53-235 [338230]
   Other proteins in same PDB: d5me7a2, d5me7c2, d5me7d2
   automated match to d2wmca_
   complexed with gol

Details for d5me7d1

PDB Entry: 5me7, 2.2 Å

PDB Description: crystal structure of eif4e from c. melo

PDB Compounds: (D:) Eukaryotic transcription initiation factor 4E

SCOPe Domain Sequences for d5me7d1:

Sequence, based on SEQRES records:

>d5me7d1 d.86.1.0 (D:53-235) automated matches {Cucumis melo [TaxId: 3656]}
aslvhqphplehswtfwfdnpsakskqatwgasirpiytfstveefwsvynnihhpskla
mradlycfkhkiepkwedpvcanggkwtvnfprgksdngwlytllamigeqfdcgdeicg
avvnvrsgqdkisiwtknasneaaqasigkqwkefldynesigfifhddakkfdrhaknk
ymv

Sequence, based on observed residues (ATOM records):

>d5me7d1 d.86.1.0 (D:53-235) automated matches {Cucumis melo [TaxId: 3656]}
aslvhqphplehswtfwfdnpirpiytfstveefwsvynnihhpsklamradlycfkhki
epkwedpvcanggkwtvnfprgksdngwlytllamigeqfdcgdeicgavvnvrsgqdki
siwtknasneaaqasigkqwkefldynesigfifhddakkfdrhaknkymv

Timeline for d5me7d1:

• d5me7d1 first appeared in SCOPe 2.06
  
• d5me7d1 appears in SCOPe 2.07