Lineage for d5me6d_ (5me6 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962641Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 2962642Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 2962762Family d.86.1.0: automated matches [191459] (1 protein)
    not a true family
  6. 2962763Protein automated matches [190708] (10 species)
    not a true protein
  7. 2962774Species Cucumis melo [TaxId:3656] [338181] (3 PDB entries)
  8. 2962783Domain d5me6d_: 5me6 D: [338227]
    Other proteins in same PDB: d5me6a2
    automated match to d2wmca_
    complexed with m7g

Details for d5me6d_

PDB Entry: 5me6 (more details), 2.9 Å

PDB Description: crystal structure of eif4e from c. melo bound to a cap analog
PDB Compounds: (D:) Eukaryotic transcription initiation factor 4E

SCOPe Domain Sequences for d5me6d_:

Sequence, based on SEQRES records: (download)

>d5me6d_ d.86.1.0 (D:) automated matches {Cucumis melo [TaxId: 3656]}
lvhqphplehswtfwfdnpsakskqatwgasirpiytfstveefwsvynnihhpsklamr
adlycfkhkiepkwedpvcanggkwtvnfprgksdngwlytllamigeqfdcgdeicgav
vnvrsgqdkisiwtknasneaaqasigkqwkefldynesigfifhddakkfdrhaknkym
v

Sequence, based on observed residues (ATOM records): (download)

>d5me6d_ d.86.1.0 (D:) automated matches {Cucumis melo [TaxId: 3656]}
lvhqphplehswtfwfdnpirpiytfstveefwsvynnihhpsklamradlycfkhkiep
kwedpvcanggkwtvnfprgksdngwlytllamigeqfdcgdeicgavvnvrsgqdkisi
wtknasneaaqasigkqwkefldynesigfifhddakkfdrhaknkymv

SCOPe Domain Coordinates for d5me6d_:

Click to download the PDB-style file with coordinates for d5me6d_.
(The format of our PDB-style files is described here.)

Timeline for d5me6d_: