Class a: All alpha proteins [46456] (290 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (28 families) |
Family a.118.1.7: Leukotriene A4 hydrolase C-terminal domain [63608] (1 protein) automatically mapped to Pfam PF09127 this is a repeat family; one repeat unit is 1gw6 A:513-547 found in domain |
Protein Leukotriene A4 hydrolase C-terminal domain [63609] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63610] (58 PDB entries) Uniprot P09960 |
Domain d5ni6a3: 5ni6 A:461-610 [338218] Other proteins in same PDB: d5ni6a1, d5ni6a2 automated match to d3u9wa3 complexed with acy, dj3, yb, zn; mutant |
PDB Entry: 5ni6 (more details), 1.54 Å
SCOPe Domain Sequences for d5ni6a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ni6a3 a.118.1.7 (A:461-610) Leukotriene A4 hydrolase C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} dmtltnacialsqrwitakeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrm qevynfnainnseirfrwlrlciqskwedaiplalkmateqgrmkftrplfkdlaafdks hdqavrtyqehkasmhpvtamlvgkdlkvd
Timeline for d5ni6a3: