Lineage for d4cpa__ (4cpa -)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 72307Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
  4. 72401Superfamily c.56.5: Zn-dependent exopeptidases [53187] (5 families) (S)
  5. 72402Family c.56.5.1: Pancreatic carboxypeptidases [53188] (3 proteins)
  6. 72403Protein Carboxypeptidase A [53189] (3 species)
  7. 72404Species Cow (Bos taurus) [TaxId:9913] [53190] (17 PDB entries)
  8. 72423Domain d4cpa__: 4cpa - [33821]
    Other proteins in same PDB: d4cpai_

Details for d4cpa__

PDB Entry: 4cpa (more details), 2.5 Å

PDB Description: refined crystal structure of the potato inhibitor complex of carboxypeptidase a at 2.5 angstroms resolution

SCOP Domain Sequences for d4cpa__:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cpa__ c.56.5.1 (-) Carboxypeptidase A {Cow (Bos taurus)}
arstntfnyatyhtldeiydfmdllvaqhpelvsklqigrsyegrpiyvlkfstggsnrp
aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth
senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
mehtvnn

SCOP Domain Coordinates for d4cpa__:

Click to download the PDB-style file with coordinates for d4cpa__.
(The format of our PDB-style files is described here.)

Timeline for d4cpa__:

View in 3D
Domains from other chains:
(mouse over for more information)
d4cpai_