Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.9: Bacterial ba3 type cytochrome c oxidase subunit IIa [81473] (1 family) automatically mapped to Pfam PF08113 |
Family f.23.9.1: Bacterial ba3 type cytochrome c oxidase subunit IIa [81472] (2 proteins) |
Protein automated matches [338206] (1 species) not a true protein |
Species Thermus thermophilus [TaxId:274] [338207] (1 PDB entry) |
Domain d5ndcc_: 5ndc C: [338208] Other proteins in same PDB: d5ndca_, d5ndcb1, d5ndcb2 automated match to d1xmec_ complexed with cu, cua, has, hem, olc |
PDB Entry: 5ndc (more details), 2.3 Å
SCOPe Domain Sequences for d5ndcc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ndcc_ f.23.9.1 (C:) automated matches {Thermus thermophilus [TaxId: 274]} kpkgalavilvltltilvfwlgvyavffarg
Timeline for d5ndcc_: