Lineage for d5ndcc_ (5ndc C:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254136Superfamily f.23.9: Bacterial ba3 type cytochrome c oxidase subunit IIa [81473] (1 family) (S)
    automatically mapped to Pfam PF08113
  5. 2254137Family f.23.9.1: Bacterial ba3 type cytochrome c oxidase subunit IIa [81472] (2 proteins)
  6. 2254166Protein automated matches [338206] (1 species)
    not a true protein
  7. 2254167Species Thermus thermophilus [TaxId:274] [338207] (1 PDB entry)
  8. 2254168Domain d5ndcc_: 5ndc C: [338208]
    Other proteins in same PDB: d5ndca_, d5ndcb1, d5ndcb2
    automated match to d1xmec_
    complexed with cu, cua, has, hem, olc

Details for d5ndcc_

PDB Entry: 5ndc (more details), 2.3 Å

PDB Description: structure of ba3-type cytochrome c oxidase from thermus thermophilus by serial femtosecond crystallography
PDB Compounds: (C:) Cytochrome c oxidase polypeptide IIA

SCOPe Domain Sequences for d5ndcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ndcc_ f.23.9.1 (C:) automated matches {Thermus thermophilus [TaxId: 274]}
kpkgalavilvltltilvfwlgvyavffarg

SCOPe Domain Coordinates for d5ndcc_:

Click to download the PDB-style file with coordinates for d5ndcc_.
(The format of our PDB-style files is described here.)

Timeline for d5ndcc_: