Class b: All beta proteins [48724] (177 folds) |
Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily) duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain |
Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) |
Family b.98.1.1: Zn aminopeptidase N-terminal domain [63738] (4 proteins) |
Protein Leukotriene A4 hydrolase N-terminal domain [63739] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63740] (56 PDB entries) Uniprot P09960 |
Domain d5ni4a1: 5ni4 A:3-208 [338197] Other proteins in same PDB: d5ni4a2, d5ni4a3, d5ni4b2, d5ni4b3, d5ni4c2, d5ni4c3 automated match to d3b7sa2 complexed with dj3, imd, zn; mutant |
PDB Entry: 5ni4 (more details), 1.9 Å
SCOPe Domain Sequences for d5ni4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ni4a1 b.98.1.1 (A:3-208) Leukotriene A4 hydrolase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} ivdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdltie kvvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltpeq tsgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpdpe dpsrkiykfiqkvpipcylialvvga
Timeline for d5ni4a1: