![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.86: eIF4e-like [55417] (1 superfamily) beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478 |
![]() | Superfamily d.86.1: eIF4e-like [55418] (3 families) ![]() |
![]() | Family d.86.1.0: automated matches [191459] (1 protein) not a true family |
![]() | Protein automated matches [190708] (10 species) not a true protein |
![]() | Species Cucumis melo [TaxId:3656] [338181] (3 PDB entries) |
![]() | Domain d5me7b_: 5me7 B: [338182] Other proteins in same PDB: d5me7a2, d5me7c2, d5me7d2 automated match to d2wmca_ complexed with gol |
PDB Entry: 5me7 (more details), 2.2 Å
SCOPe Domain Sequences for d5me7b_:
Sequence, based on SEQRES records: (download)
>d5me7b_ d.86.1.0 (B:) automated matches {Cucumis melo [TaxId: 3656]} aslvhqphplehswtfwfdnpsakskqatwgasirpiytfstveefwsvynnihhpskla mradlycfkhkiepkwedpvcanggkwtvnfprgksdngwlytllamigeqfdcgdeicg avvnvrsgqdkisiwtknasneaaqasigkqwkefldynesigfifhddakkfdrhaknk ymv
>d5me7b_ d.86.1.0 (B:) automated matches {Cucumis melo [TaxId: 3656]} aslvhqphplehswtfwfdnpssirpiytfstveefwsvynnihhpsklamradlycfkh kiepkwedpvcanggkwtvnfprgksdngwlytllamigeqfdcgdeicgavvnvrsgqd kisiwtknasneaaqasigkqwkefldynesigfifhddakkfdrhaknkymv
Timeline for d5me7b_: