| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
| Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
| Protein automated matches [190896] (11 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188315] (105 PDB entries) |
| Domain d5kwqa2: 5kwq A:201-294 [338176] Other proteins in same PDB: d5kwqa3, d5kwqb3 automated match to d2mpua_ |
PDB Entry: 5kwq (more details), 2.8 Å
SCOPe Domain Sequences for d5kwqa2:
Sequence, based on SEQRES records: (download)
>d5kwqa2 d.58.7.0 (A:201-294) automated matches {Human (Homo sapiens) [TaxId: 9606]}
laeearafnriyvasvhqdlsdddiksvfeafgkiksatlardpttgkhkgygfieyeka
qssqdavssmnlfdlggqylrvgkavtppmpllt
>d5kwqa2 d.58.7.0 (A:201-294) automated matches {Human (Homo sapiens) [TaxId: 9606]}
laeearafnriyvasvhqdlsdddiksvfeafgkiksatlardpttgkhkgygfieyeka
qssqdavssmnlfdlgqylrvgkavtppmpllt
Timeline for d5kwqa2: