Lineage for d5kwqa1 (5kwq A:101-200)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2952471Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2952472Protein automated matches [190896] (11 species)
    not a true protein
  7. 2952511Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries)
  8. 2952582Domain d5kwqa1: 5kwq A:101-200 [338175]
    Other proteins in same PDB: d5kwqa3, d5kwqb3
    automated match to d2mpua_

Details for d5kwqa1

PDB Entry: 5kwq (more details), 2.8 Å

PDB Description: two tandem rrm domains of fbp-interacting repressor (fir), also known as puf60
PDB Compounds: (A:) Poly(U)-binding-splicing factor PUF60

SCOPe Domain Sequences for d5kwqa1:

Sequence, based on SEQRES records: (download)

>d5kwqa1 d.58.7.0 (A:101-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aaqrqgalaimsrvyvgsiyyelgedtirqafapfgpiksidmswdsvtmkhkgfafvey
evpeaaqlaleqmnsvmlggrnikvgrpsnigqaqpiidq

Sequence, based on observed residues (ATOM records): (download)

>d5kwqa1 d.58.7.0 (A:101-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aaqrqgalaimsrvyvgsiyyelgedtirqafapfgpiksidmswvtmkhkgfafveyev
peaaqlaleqmnsvmlnikvgrpsnigqaqpiidq

SCOPe Domain Coordinates for d5kwqa1:

Click to download the PDB-style file with coordinates for d5kwqa1.
(The format of our PDB-style files is described here.)

Timeline for d5kwqa1: