![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
![]() | Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
![]() | Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
![]() | Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102923] (37 PDB entries) |
![]() | Domain d5x9pa1: 5x9p A:5-129 [338159] Other proteins in same PDB: d5x9pa2 automated match to d1r2ba_ complexed with 80l has additional insertions and/or extensions that are not grouped together |
PDB Entry: 5x9p (more details), 1.86 Å
SCOPe Domain Sequences for d5x9pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5x9pa1 d.42.1.1 (A:5-129) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} adsciqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdq lkcnlsvinldpeinpegfcilldfmytsrlnlregnimavmatamylqmehvvdtcrkf ikase
Timeline for d5x9pa1: