| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
| Protein automated matches [190457] (10 species) not a true protein |
| Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [338037] (2 PDB entries) |
| Domain d5xggf1: 5xgg F:2-56 [338142] Other proteins in same PDB: d5xgga2, d5xgga3, d5xggb2, d5xggb3, d5xggc2, d5xggc3, d5xggd2, d5xggd3, d5xgge2, d5xgge3, d5xggf2, d5xggf3 automated match to d1awwa_ complexed with so4 |
PDB Entry: 5xgg (more details), 1.72 Å
SCOPe Domain Sequences for d5xggf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xggf1 b.34.2.0 (F:2-56) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
lpqvkalypytaandeelsfkvgdiitilekdegwwkgelngqegwipnnyvkei
Timeline for d5xggf1: