SCOPe 2.06: Domain d5xeud_: 5xeu D:

Lineage for d5xeud_ (5xeu D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.157: Hcp1-like [141451] (1 superfamily)
   barrel, closed; n=6, S=12; contains extra, non-barrel strand 7 at the C-terminus

4. Superfamily b.157.1: Hcp1-like [141452] (2 families)
   probable biological unit is a ring-like hexamer containing a 24-stranded beta-barrel made of the subunit beta-sheets

5. Family b.157.1.0: automated matches [191591] (1 protein)
   not a true family

6. Protein automated matches [191065] (5 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:90371] [338034] (1 PDB entry)

8. Domain d5xeud_: 5xeu D: [338141]
   automated match to d4tv4a_

Details for d5xeud_

PDB Entry: 5xeu, 3 Å

PDB Description: crystal structure of hcp2 from salmonella typhimurium

PDB Compounds: (D:) Hcp1 family type VI secretion system effector

SCOPe Domain Sequences for d5xeud_:

Sequence, based on SEQRES records:

>d5xeud_ b.157.1.0 (D:) automated matches {Salmonella typhimurium [TaxId: 90371]}
ydiflkidgidgesmddkhkneievlswrwnihqestmhagsglgsgkvsvtnlsfehyi
draspnlfkycssgkhipqailvmrkaggnpleylkytftdliiamvspsgsqggeiasr
esielsfstvkqeyvvqnqqggsggtitagydfkanke

Sequence, based on observed residues (ATOM records):

>d5xeud_ b.157.1.0 (D:) automated matches {Salmonella typhimurium [TaxId: 90371]}
ydiflkidgidgesmddkhkneievlswrwnihvsvtnlsfehyidraspnlfkycssgk
hipqailvmrkaeylkytftdliiamvspsgsqasresielsfstvkqeyvvqnggtita
gydfkanke

Timeline for d5xeud_:

• d5xeud_ is new in SCOPe 2.06-stable
  
• d5xeud_ appears in SCOPe 2.07
  
• d5xeud_ appears in the current release, SCOPe 2.08