Class b: All beta proteins [48724] (180 folds) |
Fold b.157: Hcp1-like [141451] (1 superfamily) barrel, closed; n=6, S=12; contains extra, non-barrel strand 7 at the C-terminus |
Superfamily b.157.1: Hcp1-like [141452] (2 families) probable biological unit is a ring-like hexamer containing a 24-stranded beta-barrel made of the subunit beta-sheets |
Family b.157.1.0: automated matches [191591] (1 protein) not a true family |
Protein automated matches [191065] (5 species) not a true protein |
Species Salmonella typhimurium [TaxId:90371] [338034] (2 PDB entries) |
Domain d5xeud_: 5xeu D: [338141] automated match to d4tv4a_ |
PDB Entry: 5xeu (more details), 3 Å
SCOPe Domain Sequences for d5xeud_:
Sequence, based on SEQRES records: (download)
>d5xeud_ b.157.1.0 (D:) automated matches {Salmonella typhimurium [TaxId: 90371]} ydiflkidgidgesmddkhkneievlswrwnihqestmhagsglgsgkvsvtnlsfehyi draspnlfkycssgkhipqailvmrkaggnpleylkytftdliiamvspsgsqggeiasr esielsfstvkqeyvvqnqqggsggtitagydfkanke
>d5xeud_ b.157.1.0 (D:) automated matches {Salmonella typhimurium [TaxId: 90371]} ydiflkidgidgesmddkhkneievlswrwnihvsvtnlsfehyidraspnlfkycssgk hipqailvmrkaeylkytftdliiamvspsgsqasresielsfstvkqeyvvqnggtita gydfkanke
Timeline for d5xeud_: