![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) ![]() core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
![]() | Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins) |
![]() | Protein Carboxypeptidase A [53189] (4 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [53190] (34 PDB entries) |
![]() | Domain d1cpxa_: 1cpx A: [33814] truncated beta form with two zinc ions in the active site complexed with oh, zn |
PDB Entry: 1cpx (more details), 2 Å
SCOPe Domain Sequences for d1cpxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cpxa_ c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]} stntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrpai widlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafthsq nrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksivdf vkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsykygs iittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvltime htvnn
Timeline for d1cpxa_: