SCOPe 2.08: Domain d5wp0b1: 5wp0 B:1-276

Lineage for d5wp0b1 (5wp0 B:1-276)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.0: automated matches [191320] (1 protein)
   not a true family

6. Protein automated matches [190116] (28 species)
   not a true protein

7. Species Vibrio fischeri [TaxId:312309] [338049] (1 PDB entry)

8. Domain d5wp0b1: 5wp0 B:1-276 [338134]
   Other proteins in same PDB: d5wp0a2, d5wp0b2
   automated match to d1kqpa_

Details for d5wp0b1

PDB Entry: 5wp0, 2.6 Å

PDB Description: crystal structure of nad synthetase nade from vibrio fischeri

PDB Compounds: (B:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d5wp0b1:

Sequence, based on SEQRES records:

>d5wp0b1 c.26.2.0 (B:1-276) automated matches {Vibrio fischeri [TaxId: 312309]}
mqqqiveemkvkvsidpveeikkrvdfikgklleahckslilgisggvdsttcgrlaqla
vnelnletqssdyqfiavrlpygiqqdedeaqlalqfiqpthsisinikngvdglhsanh
ialkdtgllptdsakidfvkgnvkararmiaqyevagyvgglvlgtdhsaenitgfytkf
gdgacdlaplfglnkrqvrevaaqlgapeqlvkkvptadleelapqkadedalsvsydqi
ddflegkkidadaedrlikiyqmsqhkrkpiptiyd

Sequence, based on observed residues (ATOM records):

>d5wp0b1 c.26.2.0 (B:1-276) automated matches {Vibrio fischeri [TaxId: 312309]}
mqqqiveemkvkvsidpveeikkrvdfikgklleahckslilgisggvdsttcgrlaqla
vnelnletqssdyqfiavrlpygiqqdedeaqlalqfiqpthsisinikngvdglhsanh
ialkdtgllptdsakidfvkgnvkararmiaqyevagyvgglvlgtdhsaenitgfytkf
gdgacdlaplfglnkrqvrevaaqlgapeqlvkkvptadleelapdalsvsydqiddfle
gkkidadaedrlikiyqmsqhkrkpiptiyd

Timeline for d5wp0b1:

• d5wp0b1 first appeared in SCOPe 2.06
  
• d5wp0b1 appears in SCOPe 2.07