Lineage for d5wp0b1 (5wp0 B:1-276)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2861263Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2861542Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 2861543Protein automated matches [190116] (28 species)
    not a true protein
  7. 2861674Species Vibrio fischeri [TaxId:312309] [338049] (1 PDB entry)
  8. 2861676Domain d5wp0b1: 5wp0 B:1-276 [338134]
    Other proteins in same PDB: d5wp0a2, d5wp0b2
    automated match to d1kqpa_

Details for d5wp0b1

PDB Entry: 5wp0 (more details), 2.6 Å

PDB Description: crystal structure of nad synthetase nade from vibrio fischeri
PDB Compounds: (B:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d5wp0b1:

Sequence, based on SEQRES records: (download)

>d5wp0b1 c.26.2.0 (B:1-276) automated matches {Vibrio fischeri [TaxId: 312309]}
mqqqiveemkvkvsidpveeikkrvdfikgklleahckslilgisggvdsttcgrlaqla
vnelnletqssdyqfiavrlpygiqqdedeaqlalqfiqpthsisinikngvdglhsanh
ialkdtgllptdsakidfvkgnvkararmiaqyevagyvgglvlgtdhsaenitgfytkf
gdgacdlaplfglnkrqvrevaaqlgapeqlvkkvptadleelapqkadedalsvsydqi
ddflegkkidadaedrlikiyqmsqhkrkpiptiyd

Sequence, based on observed residues (ATOM records): (download)

>d5wp0b1 c.26.2.0 (B:1-276) automated matches {Vibrio fischeri [TaxId: 312309]}
mqqqiveemkvkvsidpveeikkrvdfikgklleahckslilgisggvdsttcgrlaqla
vnelnletqssdyqfiavrlpygiqqdedeaqlalqfiqpthsisinikngvdglhsanh
ialkdtgllptdsakidfvkgnvkararmiaqyevagyvgglvlgtdhsaenitgfytkf
gdgacdlaplfglnkrqvrevaaqlgapeqlvkkvptadleelapdalsvsydqiddfle
gkkidadaedrlikiyqmsqhkrkpiptiyd

SCOPe Domain Coordinates for d5wp0b1:

Click to download the PDB-style file with coordinates for d5wp0b1.
(The format of our PDB-style files is described here.)

Timeline for d5wp0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5wp0b2