Lineage for d5xg9c1 (5xg9 C:2-56)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2783360Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2783361Protein automated matches [190457] (10 species)
    not a true protein
  7. 2783420Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [338037] (2 PDB entries)
  8. 2783429Domain d5xg9c1: 5xg9 C:2-56 [338130]
    Other proteins in same PDB: d5xg9a2, d5xg9a3, d5xg9b2, d5xg9b3, d5xg9c2, d5xg9c3, d5xg9d2, d5xg9d3, d5xg9e2, d5xg9e3, d5xg9f2, d5xg9g2, d5xg9g3, d5xg9h2, d5xg9h3
    automated match to d1awwa_
    complexed with 1pe, peu, pg6, so4

Details for d5xg9c1

PDB Entry: 5xg9 (more details), 1.78 Å

PDB Description: crystal structure of peg-bound sh3 domain of myosin ib from entamoeba histolytica
PDB Compounds: (C:) Unconventional myosin IB

SCOPe Domain Sequences for d5xg9c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xg9c1 b.34.2.0 (C:2-56) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
lpqvkalypytaandeelsfkvgdiitilekdegwwkgelngqegwipnnyvkei

SCOPe Domain Coordinates for d5xg9c1:

Click to download the PDB-style file with coordinates for d5xg9c1.
(The format of our PDB-style files is described here.)

Timeline for d5xg9c1: