SCOP 1.73: Domain d1cbxa_: 1cbx A:

Lineage for d1cbxa_ (1cbx A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (8 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.1: Pancreatic carboxypeptidases [53188] (4 proteins)

6. Protein Carboxypeptidase A [53189] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53190] (27 PDB entries)

8. Domain d1cbxa_: 1cbx A: [33813]
   complexed with bzs, zn

Details for d1cbxa_

PDB Entry: 1cbx, 2 Å

PDB Description: crystal structure of the complex between carboxypeptidase a and the biproduct analog inhibitor l-benzylsuccinate at 2.0 angstroms resolution

PDB Compounds: (A:) carboxypeptidase a

SCOP Domain Sequences for d1cbxa_:

Sequence; same for both SEQRES and ATOM records:

>d1cbxa_ c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]}
arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth
senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
mehtvnn

Timeline for d1cbxa_:

• d1cbxa_ first appeared (with stable ids) in SCOP 1.55, called d1cbx__
  
• d1cbxa_ was called d1cbx__ in SCOP 1.71
  
• d1cbxa_ appears in SCOP 1.75
  
• d1cbxa_ appears in the current release, SCOPe 2.08