Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (8 families) core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
Family c.56.5.1: Pancreatic carboxypeptidases [53188] (4 proteins) |
Protein Carboxypeptidase A [53189] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [53190] (27 PDB entries) |
Domain d1cbxa_: 1cbx A: [33813] complexed with bzs, zn |
PDB Entry: 1cbx (more details), 2 Å
SCOP Domain Sequences for d1cbxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cbxa_ c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]} arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti mehtvnn
Timeline for d1cbxa_: